![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) ![]() contains barrel, closed, n=7, S=10 |
![]() | Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
![]() | Protein Pyruvate phosphate dikinase, central domain [52011] (3 species) |
![]() | Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries) |
![]() | Domain d2dika2: 2dik A:377-505 [30704] Other proteins in same PDB: d2dika1, d2dika3 complexed with so4; mutant |
PDB Entry: 2dik (more details), 2.5 Å
SCOPe Domain Sequences for d2dika2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dika2 c.8.1.1 (A:377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]} lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi sldgstgki
Timeline for d2dika2: