SCOPe 2.08: Domain d4b6ca_: 4b6c A:

Lineage for d4b6ca_ (4b6c A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [228578] (2 PDB entries)

8. Domain d4b6ca_: 4b6c A: [307038]
   automated match to d5d7rb_
   protein/DNA complex; complexed with b5u, na

Details for d4b6ca_

PDB Entry: 4b6c, 2.2 Å

PDB Description: structure of the m. smegmatis gyrb atpase domain in complex with an aminopyrazinamide

PDB Compounds: (A:) DNA gyrase subunit B,DNA gyrase subunit B,DNA gyrase subunit B

SCOPe Domain Sequences for d4b6ca_:

Sequence, based on SEQRES records:

>d4b6ca_ d.122.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
stgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddgrgipvemhatgmpt
idvvmtqvgvsvvnalstrleatvlrdgyewfqyydrsvpgklkqggetketgttirfwa
dpeifettdynfetvarrlqemaflnkgltieltderdgkhrvfhypg

Sequence, based on observed residues (ATOM records):

>d4b6ca_ d.122.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
stgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddgrgipvptidvvmtq
vgvsvvnalstrleatvlrdgyewfqyydrsvpgklkqggetketgttirfwadpeifet
tdynfetvarrlqemaflnkgltieltderdgkhrvfhypg

Timeline for d4b6ca_:

• d4b6ca_ first appeared in SCOPe 2.06
  
• d4b6ca_ appears in SCOPe 2.07