Lineage for d4b1ha_ (4b1h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120716Family c.50.1.3: Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain-like [310642] (2 protein domains)
    Pfam PF05028
    Contains N- and C-terminal extensions to macrodomain, including Tyr clasp, discussed in PubMed 22609859
  6. 2120740Protein automated matches [310881] (1 species)
    not a true protein
  7. 2120741Species Human (Homo sapiens) [TaxId:9606] [311355] (6 PDB entries)
  8. 2120746Domain d4b1ha_: 4b1h A: [307035]
    automated match to d3ueka_
    complexed with ar6, bme, dtv, gol, so4

Details for d4b1ha_

PDB Entry: 4b1h (more details), 2 Å

PDB Description: Structure of human PARG catalytic domain in complex with ADP-ribose
PDB Compounds: (A:) Poly(ADP-ribose) glycohydrolase

SCOPe Domain Sequences for d4b1ha_:

Sequence, based on SEQRES records: (download)

>d4b1ha_ c.50.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdlwdnkh
vkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvayskkwdf
talidfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeqi
asllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtaaa
ptglvtftrqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvtsa
glvqeeirflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgse
rddwqrrcteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgnw
gcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvyk
lllryyneecrncstpgpdiklypfiyhavesc

Sequence, based on observed residues (ATOM records): (download)

>d4b1ha_ c.50.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdlwdnkh
vkmpcseqnlypvrtagsrweliqtallnkftrpqnlkdailkynvayskkwdftalidf
wdkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeqiasllan
affctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtaaaptglvt
ftrqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvtsaglvqee
irflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgserddwqr
rcteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgnwgcgafg
gdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvyklllryy
neecrncstpgpdiklypfiyhavesc

SCOPe Domain Coordinates for d4b1ha_:

Click to download the PDB-style file with coordinates for d4b1ha_.
(The format of our PDB-style files is described here.)

Timeline for d4b1ha_:

  • d4b1ha_ is new in SCOPe 2.06-stable