SCOPe 2.06: Domain d1ggoa2: 1ggo A:377-505

Lineage for d1ggoa2 (1ggo A:377-505)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)

6. Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)

7. Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)

8. Domain d1ggoa2: 1ggo A:377-505 [30703]
   Other proteins in same PDB: d1ggoa1, d1ggoa3
   complexed with so4; mutant

Details for d1ggoa2

PDB Entry: 1ggo, 2.6 Å

PDB Description: t453a mutant of pyruvate, phosphate dikinase

PDB Compounds: (A:) protein (pyruvate, phosphate dikinase)

SCOPe Domain Sequences for d1ggoa2:

Sequence; same for both SEQRES and ATOM records:

>d1ggoa2 c.8.1.1 (A:377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmashaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgki

Timeline for d1ggoa2:

• d1ggoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ggoa2 appears in SCOPe 2.05
  
• d1ggoa2 appears in SCOPe 2.07
  
• d1ggoa2 appears in the current release, SCOPe 2.08