| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) ![]() contains barrel, closed, n=7, S=10 |
| Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
| Protein Pyruvate phosphate dikinase, central domain [52011] (3 species) |
| Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries) |
| Domain d1ggoa2: 1ggo A:377-505 [30703] Other proteins in same PDB: d1ggoa1, d1ggoa3 complexed with so4; mutant |
PDB Entry: 1ggo (more details), 2.6 Å
SCOPe Domain Sequences for d1ggoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggoa2 c.8.1.1 (A:377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmashaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgki
Timeline for d1ggoa2: