![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
![]() | Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) ![]() |
![]() | Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein) |
![]() | Protein Pyruvate phosphate dikinase, central domain [52011] (1 species) |
![]() | Species Clostridium symbiosum [TaxId:1512] [52012] (3 PDB entries) |
![]() | Domain d1ggoa2: 1ggo A:377-505 [30703] Other proteins in same PDB: d1ggoa1, d1ggoa3 |
PDB Entry: 1ggo (more details), 2.6 Å
SCOP Domain Sequences for d1ggoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggoa2 c.8.1.1 (A:377-505) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum} lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi egmhaaegiltvrggmashaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi sldgstgki
Timeline for d1ggoa2: