Lineage for d4an4d1 (4an4 D:13-390)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142601Species Streptomyces nogalater [TaxId:38314] [311356] (3 PDB entries)
  8. 2142609Domain d4an4d1: 4an4 D:13-390 [307023]
    Other proteins in same PDB: d4an4a2, d4an4b2, d4an4c2, d4an4d2
    automated match to d2p6pb_
    complexed with dud

Details for d4an4d1

PDB Entry: 4an4 (more details), 2.7 Å

PDB Description: Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater
PDB Compounds: (D:) glycosyl transferase

SCOPe Domain Sequences for d4an4d1:

Sequence, based on SEQRES records: (download)

>d4an4d1 c.87.1.0 (D:13-390) automated matches {Streptomyces nogalater [TaxId: 38314]}
mralfitspglshilptvplaqalralghevryatggdiravaeaglcavdvspgvnyak
lfvpddtdvtdpmhseglgegffaemfarvsavavdgalrtarswrpdlvvhtptqgagp
ltaaalqlpcvelplgpadsepglgalirramskdyerhgvtgeptgsvrltttppsvea
llpedrrspgawpmryvpynggavlpdwlppaagrrriavtlgsidalsggiaklaplfs
evadvdaefvltlgggdlallgelpanvrvvewiplgalletcdaiihhggsgtlltala
agvpqcviphgsyqdtnrdvltglgigfdaeagslgaeqcrrllddaglreaalrvrqem
sempppaetaaklvalag

Sequence, based on observed residues (ATOM records): (download)

>d4an4d1 c.87.1.0 (D:13-390) automated matches {Streptomyces nogalater [TaxId: 38314]}
mralfitspglshilptvplaqalralghevryatggdiravaeaglcavdvspgvnyak
legffaemfarvsavavdgalrtarswrpdlvvhtptqgagpltaaalqlpcvelplgpa
dgalirramskdyerhgvtgeptgsvrltttppsveallpedrrspgawpmryvpyngga
vlpdwlppaagrrriavtlgsidaliaklaplfsevadvdaefvltlgggdlallgpanv
rvvewiplgalletcdaiihhggsgtlltalaagvpqcviphgdtnrdvltglgigfdae
agslgaeqcrrllddaglreaalrvrqemsempppaetaaklvalag

SCOPe Domain Coordinates for d4an4d1:

Click to download the PDB-style file with coordinates for d4an4d1.
(The format of our PDB-style files is described here.)

Timeline for d4an4d1:

  • d4an4d1 is new in SCOPe 2.06-stable