Lineage for d4amgb1 (4amg B:13-389)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142601Species Streptomyces nogalater [TaxId:38314] [311356] (3 PDB entries)
  8. 2142603Domain d4amgb1: 4amg B:13-389 [307011]
    Other proteins in same PDB: d4amga2, d4amgb2
    automated match to d2p6pb_

Details for d4amgb1

PDB Entry: 4amg (more details), 2.59 Å

PDB Description: Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater
PDB Compounds: (B:) snogd

SCOPe Domain Sequences for d4amgb1:

Sequence, based on SEQRES records: (download)

>d4amgb1 c.87.1.0 (B:13-389) automated matches {Streptomyces nogalater [TaxId: 38314]}
mralfitspglshilptvplaqalralghevryatggdiravaeaglcavdvspgvnyak
lfvpddtdvtdpmhseglgegffaemfarvsavavdgalrtarswrpdlvvhtptqgagp
ltaaalqlpcvelplgpadsepglgalirramskdyerhgvtgeptgsvrltttppsvea
llpedrrspgawpmryvpynggavlpdwlppaagrrriavtlgsidalsggiaklaplfs
evadvdaefvltlgggdlallgelpanvrvvewiplgalletcdaiihhggsgtlltala
agvpqcviphgsyqdtnrdvltglgigfdaeagslgaeqcrrllddaglreaalrvrqem
sempppaetaaklvala

Sequence, based on observed residues (ATOM records): (download)

>d4amgb1 c.87.1.0 (B:13-389) automated matches {Streptomyces nogalater [TaxId: 38314]}
mralfitspglshilptvplaqalralghevryatggdiravaeaglcavdvspgvnyak
lfvpddpmhseglgegffaemfarvsavavdgalrtarswrpdlvvhtptqgagpltaaa
lqlpcvelplgpadsepglgalirramskdyerhgvtgeptgsvrltttppsveallped
rrspgawpmryvpynggavlpdwlppaagrrriavtlgsidalsggiaklaplfsevadv
daefvltlgggdlallgelpanvrvvewiplgalletcdaiihhggsgtlltalaagvpq
cviphgtnrdvltglgigfdaeagslgaeqcrrllddaglreaalrvrqemsempppaet
aaklvala

SCOPe Domain Coordinates for d4amgb1:

Click to download the PDB-style file with coordinates for d4amgb1.
(The format of our PDB-style files is described here.)

Timeline for d4amgb1:

  • d4amgb1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4amgb2