Lineage for d4a9pa_ (4a9p A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320455Domain d4a9pa_: 4a9p A: [306997]
    automated match to d2yw5a_
    complexed with a9p, edo, so4

Details for d4a9pa_

PDB Entry: 4a9p (more details), 1.78 Å

PDB Description: n-terminal bromodomain of human brd2 with 3,5 dimethyl-4-phenyl-1,2- oxazole
PDB Compounds: (A:) bromodomain containing 2

SCOPe Domain Sequences for d4a9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a9pa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlenn
yywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelv

SCOPe Domain Coordinates for d4a9pa_:

Click to download the PDB-style file with coordinates for d4a9pa_.
(The format of our PDB-style files is described here.)

Timeline for d4a9pa_: