Lineage for d3zy1a_ (3zy1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714980Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2714981Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2715047Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2715048Protein automated matches [259190] (2 species)
    not a true protein
  7. 2715049Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2715068Domain d3zy1a_: 3zy1 A: [306993]
    automated match to d4d1ld_

Details for d3zy1a_

PDB Entry: 3zy1 (more details), 2.15 Å

PDB Description: crystal structure of the human p63 tetramerization domain
PDB Compounds: (A:) Tumor protein 63

SCOPe Domain Sequences for d3zy1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zy1a_ a.53.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dellylpvrgretyemllkikeslelmqylpqhtietyrq

SCOPe Domain Coordinates for d3zy1a_:

Click to download the PDB-style file with coordinates for d3zy1a_.
(The format of our PDB-style files is described here.)

Timeline for d3zy1a_: