SCOPe 2.08: Domain d3x3gl1: 3x3g L:1-106

Lineage for d3x3gl1 (3x3g L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3x3gl1: 3x3g L:1-106 [306972]
   Other proteins in same PDB: d3x3gh_, d3x3gl2
   automated match to d1dn0a1
   complexed with cl, nag, so4

Details for d3x3gl1

PDB Entry: 3x3g, 2.51 Å

PDB Description: fab fragment from anti trail-r2 human agonist antibody kmtr2

PDB Compounds: (L:) Light chain of KMTR2

SCOPe Domain Sequences for d3x3gl1:

Sequence; same for both SEQRES and ATOM records:

>d3x3gl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgggtkvei

Timeline for d3x3gl1:

• d3x3gl1 first appeared in SCOPe 2.06
  
• d3x3gl1 appears in SCOPe 2.07