Lineage for d3wzqd1 (3wzq D:13-135)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415735Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. 2415866Domain d3wzqd1: 3wzq D:13-135 [306966]
    Other proteins in same PDB: d3wzqa2, d3wzqb2, d3wzqc2, d3wzqd2
    automated match to d4ekva_
    complexed with p6g, zof; mutant

Details for d3wzqd1

PDB Entry: 3wzq (more details), 1.7 Å

PDB Description: crystal structure of the core streptavidin mutant v212 (y22s/n23d/s27d/s45n/y83s/r84k/e101d/r103k/e116n) complexed with iminobiotin long tail (imntail) at 1.7 a resolution
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d3wzqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wzqd1 b.61.1.1 (D:13-135) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsgta
lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d3wzqd1:

Click to download the PDB-style file with coordinates for d3wzqd1.
(The format of our PDB-style files is described here.)

Timeline for d3wzqd1: