Lineage for d3wzpc1 (3wzp C:13-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806229Domain d3wzpc1: 3wzp C:13-134 [306956]
    Other proteins in same PDB: d3wzpa2, d3wzpb2, d3wzpc2, d3wzpd2
    automated match to d1n9mc_
    complexed with gol, zof; mutant

Details for d3wzpc1

PDB Entry: 3wzp (more details), 1.2 Å

PDB Description: crystal structure of the core streptavidin mutant v21 (y22s/n23d/s27d/y83s/r84k/e101d/r103k/e116n) complexed with iminobiotin long tail (imntail) at 1.2 a resolution
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d3wzpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wzpc1 b.61.1.1 (C:13-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
vk

SCOPe Domain Coordinates for d3wzpc1:

Click to download the PDB-style file with coordinates for d3wzpc1.
(The format of our PDB-style files is described here.)

Timeline for d3wzpc1: