Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries) |
Domain d3wzpb1: 3wzp B:13-133 [306954] Other proteins in same PDB: d3wzpa2, d3wzpb2, d3wzpc2, d3wzpd2 automated match to d1n9mc_ complexed with gol, zof; mutant |
PDB Entry: 3wzp (more details), 1.2 Å
SCOPe Domain Sequences for d3wzpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wzpb1 b.61.1.1 (B:13-133) automated matches {Streptomyces avidinii [TaxId: 1895]} aeagitgtwsdqlgdtfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk v
Timeline for d3wzpb1: