SCOP 1.73: Domain d3r1rc2: 3r1r C:222-737

Lineage for d3r1rc2 (3r1r C:222-737)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
   contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel

4. Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (4 families)
   duplication: the N- and C-terminal halves have similar topologies

5. Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)

7. Species Escherichia coli [TaxId:562] [52004] (8 PDB entries)

8. Domain d3r1rc2: 3r1r C:222-737 [30694]
   Other proteins in same PDB: d3r1ra1, d3r1rb1, d3r1rc1
   complexed with atp

Details for d3r1rc2

PDB Entry: 3r1r, 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli

PDB Compounds: (C:) ribonucleotide reductase r1 protein

SCOP Domain Sequences for d3r1rc2:

Sequence; same for both SEQRES and ATOM records:

>d3r1rc2 c.7.1.2 (C:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrdg

Timeline for d3r1rc2:

• d3r1rc2 first appeared (with stable ids) in SCOP 1.55
  
• d3r1rc2 appears in SCOP 1.71
  
• d3r1rc2 appears in SCOP 1.75
  
• d3r1rc2 appears in the current release, SCOPe 2.08