SCOPe 2.07: Domain d3wyja_: 3wyj A:

Lineage for d3wyja_ (3wyj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d3wyja_: 3wyj A: [306936]
   automated match to d1ueha_
   complexed with h78

Details for d3wyja_

PDB Entry: 3wyj, 2.1 Å

PDB Description: structure of e. coli undecaprenyl diphosphate synthase in complex with bph-789

PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d3wyja_:

Sequence, based on SEQRES records:

>d3wyja_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse
nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag
ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi
rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d3wyja_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssp
aqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntglt
lniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtgge
hrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d3wyja_:

• d3wyja_ first appeared in SCOPe 2.06
  
• d3wyja_ appears in the current release, SCOPe 2.08