Lineage for d3wyia_ (3wyi A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526295Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2526296Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2526297Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2526340Protein automated matches [190121] (4 species)
    not a true protein
  7. 2526359Species Staphylococcus aureus [TaxId:1280] [311352] (1 PDB entry)
  8. 2526360Domain d3wyia_: 3wyi A: [306935]
    automated match to d4u82a_
    complexed with mg

Details for d3wyia_

PDB Entry: 3wyi (more details), 2 Å

PDB Description: structure of s. aureus undecaprenyl diphosphate synthase
PDB Compounds: (A:) Isoprenyl transferase

SCOPe Domain Sequences for d3wyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wyia_ c.101.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eeldssnipehiaiimdgngrwakkrkmprikghyegmqtikkitriasdigvkyltlya
fstenwsrpesevnyimnlpvnflktflpelieknvkvetigftdklpkstieainnake
ktanntglklifainyggraelvhsiknmfdelhqqglnsdiidetyinnhlmtkdypdp
ellirtsgeqrisnfliwqvsysefifnqklwpdfdedelikcikiyqsrq

SCOPe Domain Coordinates for d3wyia_:

Click to download the PDB-style file with coordinates for d3wyia_.
(The format of our PDB-style files is described here.)

Timeline for d3wyia_: