Lineage for d3r1ra2 (3r1r A:222-737)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979653Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 979654Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (5 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 979680Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
  6. 979681Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 979682Species Escherichia coli [TaxId:562] [52004] (8 PDB entries)
  8. 979699Domain d3r1ra2: 3r1r A:222-737 [30692]
    Other proteins in same PDB: d3r1ra1, d3r1rb1, d3r1rc1
    complexed with atp

Details for d3r1ra2

PDB Entry: 3r1r (more details), 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli
PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d3r1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r1ra2 c.7.1.2 (A:222-737) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrdg

SCOPe Domain Coordinates for d3r1ra2:

Click to download the PDB-style file with coordinates for d3r1ra2.
(The format of our PDB-style files is described here.)

Timeline for d3r1ra2: