Lineage for d3wtoc1 (3wto C:2-206)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084696Protein automated matches [190922] (2 species)
    not a true protein
  7. 2084697Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2084830Domain d3wtoc1: 3wto C:2-206 [306919]
    Other proteins in same PDB: d3wtoa2, d3wtob2, d3wtoc2, d3wtod2, d3wtoe2
    automated match to d2zjub_
    complexed with n2y; mutant

Details for d3wtoc1

PDB Entry: 3wto (more details), 2.25 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein Q55R Mutant Complexed with Desnitro-imidacloprid
PDB Compounds: (C:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtoc1 b.96.1.1 (C:2-206) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqrttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgr

SCOPe Domain Coordinates for d3wtoc1:

Click to download the PDB-style file with coordinates for d3wtoc1.
(The format of our PDB-style files is described here.)

Timeline for d3wtoc1: