SCOPe 2.08: Domain d3wtnj1: 3wtn J:2-205

Lineage for d3wtnj1 (3wtn J:2-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d3wtnj1: 3wtn J:2-205 [306913]
   Other proteins in same PDB: d3wtna2, d3wtnb2, d3wtnc2, d3wtnd2, d3wtne2, d3wtnf2, d3wtng2, d3wtnh2, d3wtni2, d3wtnj2
   automated match to d2zjub_
   complexed with cd, n2y, na

Details for d3wtnj1

PDB Entry: 3wtn, 2.09 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with Desnitro-imidacloprid

PDB Compounds: (J:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtnj1:

Sequence; same for both SEQRES and ATOM records:

>d3wtnj1 b.96.1.1 (J:2-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

Timeline for d3wtnj1:

• d3wtnj1 first appeared in SCOPe 2.06
  
• d3wtnj1 appears in SCOPe 2.07