Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily) contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel |
Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) duplication: the N- and C-terminal halves have similar topologies |
Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein) automatically mapped to Pfam PF02867 |
Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species) |
Species Escherichia coli [TaxId:562] [52004] (8 PDB entries) |
Domain d7r1rc2: 7r1r C:222-738 [30691] Other proteins in same PDB: d7r1ra1, d7r1rb1, d7r1rc1 mutant |
PDB Entry: 7r1r (more details), 3.1 Å
SCOPe Domain Sequences for d7r1rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7r1rc2 c.7.1.2 (C:222-738) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]} fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlclqialptkplndvndengeial ctlsafnlgainnldeleelailavraldalldyqdypipaakrgamgrrtlgigvinfa yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp srfpsgkvpmqqllkdlltaykfgvktlyyqntrdga
Timeline for d7r1rc2:
View in 3D Domains from other chains: (mouse over for more information) d7r1ra1, d7r1ra2, d7r1rb1, d7r1rb2 |