Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d3wtne1: 3wtn E:2-205 [306903] Other proteins in same PDB: d3wtna2, d3wtnb2, d3wtnc2, d3wtnd2, d3wtne2, d3wtnf2, d3wtng2, d3wtnh2, d3wtni2, d3wtnj2 automated match to d2zjub_ complexed with cd, n2y, na |
PDB Entry: 3wtn (more details), 2.09 Å
SCOPe Domain Sequences for d3wtne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtne1 b.96.1.1 (E:2-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkkg
Timeline for d3wtne1: