SCOPe 2.06: Domain d3wtkb1: 3wtk B:2-208

Lineage for d3wtkb1 (3wtk B:2-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)

8. Domain d3wtkb1: 3wtk B:2-208 [306867]
   Other proteins in same PDB: d3wtka2, d3wtkb2, d3wtkc2, d3wtkd2, d3wtke2
   automated match to d2zjub_
   complexed with th4; mutant

Details for d3wtkb1

PDB Entry: 3wtk, 2.69 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein Q55R Mutant Complexed with Thiacloprid

PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtkb1:

Sequence; same for both SEQRES and ATOM records:

>d3wtkb1 b.96.1.1 (B:2-208) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqrttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgrse

Timeline for d3wtkb1:

• d3wtkb1 is new in SCOPe 2.06-stable
  
• d3wtkb1 appears in SCOPe 2.07
  
• d3wtkb1 appears in the current release, SCOPe 2.08