SCOPe 2.06: Domain d3wtja1: 3wtj A:2-207

Lineage for d3wtja1 (3wtj A:2-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)

8. Domain d3wtja1: 3wtj A:2-207 [306855]
   Other proteins in same PDB: d3wtja2, d3wtjb2, d3wtjc2, d3wtjd2, d3wtje2
   automated match to d2zjub_
   complexed with th4

Details for d3wtja1

PDB Entry: 3wtj, 2.24 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with Thiacloprid

PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtja1:

Sequence; same for both SEQRES and ATOM records:

>d3wtja1 b.96.1.1 (A:2-207) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgrs

Timeline for d3wtja1:

• d3wtja1 is new in SCOPe 2.06-stable
  
• d3wtja1 appears in SCOPe 2.07
  
• d3wtja1 appears in the current release, SCOPe 2.08