Lineage for d3wtha1 (3wth A:2-207)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408207Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (33 PDB entries)
  8. 2408398Domain d3wtha1: 3wth A:2-207 [306835]
    Other proteins in same PDB: d3wtha2, d3wthb2, d3wthc2, d3wthd2, d3wthe2
    automated match to d2zjub_
    complexed with im4; mutant

Details for d3wtha1

PDB Entry: 3wth (more details), 2.54 Å

PDB Description: Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein Q55R Mutant Complexed with Imidacloprid
PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d3wtha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtha1 b.96.1.1 (A:2-207) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqrttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgrs

SCOPe Domain Coordinates for d3wtha1:

Click to download the PDB-style file with coordinates for d3wtha1.
(The format of our PDB-style files is described here.)

Timeline for d3wtha1: