| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
| Family d.1.1.0: automated matches [258602] (1 protein) not a true family |
| Protein automated matches [258603] (2 species) not a true protein |
| Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [258604] (2 PDB entries) |
| Domain d3wr2f_: 3wr2 F: [306834] automated match to d3whoa_ complexed with 3gp |
PDB Entry: 3wr2 (more details), 1.75 Å
SCOPe Domain Sequences for d3wr2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wr2f_ d.1.1.0 (F:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
svysggspgadrviydqsgrfcaclthtgapstngfvecrf
Timeline for d3wr2f_: