Lineage for d3wr2f_ (3wr2 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2924164Family d.1.1.0: automated matches [258602] (1 protein)
    not a true family
  6. 2924165Protein automated matches [258603] (2 species)
    not a true protein
  7. 2924170Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [258604] (2 PDB entries)
  8. 2924176Domain d3wr2f_: 3wr2 F: [306834]
    automated match to d3whoa_
    complexed with 3gp

Details for d3wr2f_

PDB Entry: 3wr2 (more details), 1.75 Å

PDB Description: rnase po1 complexed with 3'gmp
PDB Compounds: (F:) Guanyl-specific ribonuclease Po1

SCOPe Domain Sequences for d3wr2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wr2f_ d.1.1.0 (F:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
svysggspgadrviydqsgrfcaclthtgapstngfvecrf

SCOPe Domain Coordinates for d3wr2f_:

Click to download the PDB-style file with coordinates for d3wr2f_.
(The format of our PDB-style files is described here.)

Timeline for d3wr2f_: