SCOPe 2.07: Domain d3wmoc_: 3wmo C:

Lineage for d3wmoc_ (3wmo C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein automated matches [227073] (3 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267911] (4 PDB entries)

8. Domain d3wmoc_: 3wmo C: [306790]
   Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_
   automated match to d3wmmc_
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmoc_

PDB Entry: 3wmo, 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3wmoc_:

Sequence; same for both SEQRES and ATOM records:

>d3wmoc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
plygaqmakdypglykt

Timeline for d3wmoc_:

• d3wmoc_ first appeared in SCOPe 2.06