![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
![]() | Protein automated matches [227073] (3 species) not a true protein |
![]() | Species Thermochromatium tepidum [TaxId:1050] [267911] (5 PDB entries) |
![]() | Domain d3wmoc_: 3wmo C: [306790] Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_ automated match to d3wmmc_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8 |
PDB Entry: 3wmo (more details), 3.01 Å
SCOPe Domain Sequences for d3wmoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmoc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]} svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk plygaqmakdypglykt
Timeline for d3wmoc_:
![]() Domains from other chains: (mouse over for more information) d3wmo0_, d3wmo1_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_ |