Lineage for d3wmoc_ (3wmo C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734274Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2734307Protein automated matches [227073] (3 species)
    not a true protein
  7. 2734313Species Thermochromatium tepidum [TaxId:1050] [267911] (5 PDB entries)
  8. 2734317Domain d3wmoc_: 3wmo C: [306790]
    Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_
    automated match to d3wmmc_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmoc_

PDB Entry: 3wmo (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3wmoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmoc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
plygaqmakdypglykt

SCOPe Domain Coordinates for d3wmoc_:

Click to download the PDB-style file with coordinates for d3wmoc_.
(The format of our PDB-style files is described here.)

Timeline for d3wmoc_: