Lineage for d1rlra2 (1rlr A:222-748)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097807Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
    automatically mapped to Pfam PF02867
  6. 2097808Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 2097809Species Escherichia coli [TaxId:562] [52004] (10 PDB entries)
  8. 2097813Domain d1rlra2: 1rlr A:222-748 [30679]
    Other proteins in same PDB: d1rlra1

Details for d1rlra2

PDB Entry: 1rlr (more details), 2.5 Å

PDB Description: structure of ribonucleotide reductase protein r1
PDB Compounds: (A:) ribonucleotide reductase protein r1

SCOPe Domain Sequences for d1rlra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlra2 c.7.1.2 (A:222-748) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
fsscvliecgdsldsinatssaivkyvsqragiginagriralgspirggeafhtgcipf
ykhfqtavkscsqggvrggaatlfypmwhlevesllvlknnrgvegnrvrhmdygvqink
lmytrllkgeditlfspsdvpglydaffadqeeferlytkyekddsirkqrvkavelfsl
mmqerastgriyiqnvdhcnthspfdpaiapvrqsnlcleialptkplndvndengeial
ctlsafnlgainnldeldelailavraldalldyqdypipaakrgamgrrtlgigvinfa
yylakhgkrysdgsannlthktfeaiqyyllkasnelakeqgacpwfnettyakgilpid
tykkdldtianeplhydwealresikthglrnstlsalmpsetssqisnatngiepprgy
vsikaskdgilrqvvpdyehlhdayellwempgndgylqlvgimqkfidqsisantnydp
srfpsgkvpmqqllkdlltaykfgvktlyyqntrddiddlsnfql

SCOPe Domain Coordinates for d1rlra2:

Click to download the PDB-style file with coordinates for d1rlra2.
(The format of our PDB-style files is described here.)

Timeline for d1rlra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlra1