Lineage for d1qhmb_ (1qhm B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097780Family c.7.1.1: PFL-like [51999] (2 protein domains)
    Pfam PF02901; except the C-terminal ~100 residues covered by Pfam PF01228
  6. 2097791Protein Pyruvate formate-lyase, PFL [52000] (1 species)
  7. 2097792Species Escherichia coli [TaxId:562] [52001] (8 PDB entries)
  8. 2097806Domain d1qhmb_: 1qhm B: [30678]

Details for d1qhmb_

PDB Entry: 1qhm (more details), 2.8 Å

PDB Description: escherichia coli pyruvate formate lyase large domain
PDB Compounds: (B:) Pyruvate formate-lyase

SCOPe Domain Sequences for d1qhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhmb_ c.7.1.1 (B:) Pyruvate formate-lyase, PFL {Escherichia coli [TaxId: 562]}
neklatawegftkgdwqnevnvrdfiqknytpyegdesflagateatttlwdkvmegvkl
enrthapvdfdtavastitshdagyinkqlekivglqteaplkralipfggikmiegsck
aynreldpmikkifteyrkthnqgvfdvytpdilrcrksgvltglpdaygrgriigdyrr
valygidylmkdklaqftslqadlengvnleqtirlreeiaeqhralgqmkemaakygyd
isgpatnaqeaiqwtyfgylaavksqngaamsfgrtstfldvyierdlkagkiteqeaqe
mvdhlvmklrmvrflrtpeydelfsgdpiwatesiggmgldgrtlvtknsfrflntlytm
gpspepnmtilwseklplnfkkfaakvsidtsslqyenddlmrpdfnnddyaiaccvspm
ivgkqmqffgaranlaktmlyainggvdeklkmqvgpksepikgdvlnydevmermdhfm
dwlakqyitalniihymhdkysyeaslmalhdrdvirtmacgiaglsvaadslsaikyak
vkpirdedglaidfeiegeypqfgnndprvddlavdlverfmkkiqklhtyrdaiptqsv
ltitsnvvygkk

SCOPe Domain Coordinates for d1qhmb_:

Click to download the PDB-style file with coordinates for d1qhmb_.
(The format of our PDB-style files is described here.)

Timeline for d1qhmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qhma_