Lineage for d2pflb_ (2pfl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097780Family c.7.1.1: PFL-like [51999] (2 protein domains)
    Pfam PF02901; except the C-terminal ~100 residues covered by Pfam PF01228
  6. 2097791Protein Pyruvate formate-lyase, PFL [52000] (1 species)
  7. 2097792Species Escherichia coli [TaxId:562] [52001] (8 PDB entries)
  8. 2097802Domain d2pflb_: 2pfl B: [30676]
    complexed with cl, na

Details for d2pflb_

PDB Entry: 2pfl (more details), 2.9 Å

PDB Description: crystal structure of pfl from e.coli
PDB Compounds: (B:) protein (pyruvate formate-lyase)

SCOPe Domain Sequences for d2pflb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pflb_ c.7.1.1 (B:) Pyruvate formate-lyase, PFL {Escherichia coli [TaxId: 562]}
selneklatawegftkgdwqnevnvrdfiqknytpyegdesflagateatttlwdkvmeg
vklenrthapvdfdtavastitshdagyinkqlekivglqteaplkralipfggikmieg
sckaynreldpmikkifteyrkthnqgvfdvytpdilrcrksgvltglpdaygrgriigd
yrrvalygidylmkdklaqftslqadlengvnleqtirlreeiaeqhralgqmkemaaky
gydisgpatnaqeaiqwtyfgylaavksqngaamsfgrtstfldvyierdlkagkiteqe
aqemvdhlvmklrmvrflrtpeydelfsgdpiwatesiggmgldgrtlvtknsfrflntl
ytmgpspepnmtilwseklplnfkkfaakvsidtsslqyenddlmrpdfnnddyaiaccv
spmivgkqmqffgaranlaktmlyainggvdeklkmqvgpksepikgdvlnydevmermd
hfmdwlakqyitalniihymhdkysyeaslmalhdrdvirtmacgiaglsvaadslsaik
yakvkpirdedglaidfeiegeypqfgnndprvddlavdlverfmkkiqklhtyrdaipt
qsvltitsnvvygkktgntpdgrragapfgpganpmhgrdqkgavasltsvaklpfayak
dgisytfsivpnalgkddevrktnlaglmdgyfhheasieggqhlnvnvmnremlldame
npekypqltirvsgyavrfnsltkeqqqdvitrtftqsm

SCOPe Domain Coordinates for d2pflb_:

Click to download the PDB-style file with coordinates for d2pflb_.
(The format of our PDB-style files is described here.)

Timeline for d2pflb_: