Lineage for d3wmdb1 (3wmd B:1-144)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2506189Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2506190Protein automated matches [190205] (28 species)
    not a true protein
  7. 2506309Species Streptomyces cinnamonensis [TaxId:1900] [311349] (1 PDB entry)
  8. 2506311Domain d3wmdb1: 3wmd B:1-144 [306754]
    Other proteins in same PDB: d3wmdb2
    automated match to d5cxoa_

Details for d3wmdb1

PDB Entry: 3wmd (more details), 2 Å

PDB Description: crystal structure of epoxide hydrolase monbi
PDB Compounds: (B:) Probable monensin biosynthesis isomerase

SCOPe Domain Sequences for d3wmdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmdb1 d.17.4.0 (B:1-144) automated matches {Streptomyces cinnamonensis [TaxId: 1900]}
mnefarkkralehsrrinagdldaiidlyapdavledpvglppvtghdalrahyepllaa
hlreeaaepvagqdathaliqissvmdylpvgplyaergwlkapdapgtarihrtamlvi
rmdasglirhlksywgtsdltvlg

SCOPe Domain Coordinates for d3wmdb1:

Click to download the PDB-style file with coordinates for d3wmdb1.
(The format of our PDB-style files is described here.)

Timeline for d3wmdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wmdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3wmda_