Lineage for d3weoa2 (3weo A:300-672)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418763Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2418767Protein Maltase, catalytic domain [310751] (1 species)
  7. 2418768Species Beta vulgaris [TaxId:161934] [311006] (6 PDB entries)
  8. 2418769Domain d3weoa2: 3weo A:300-672 [306746]
    Other proteins in same PDB: d3weoa1, d3weoa3, d3weoa4
    automated match to d3w38a2
    complexed with gol, nag, so4

Details for d3weoa2

PDB Entry: 3weo (more details), 1.45 Å

PDB Description: Sugar beet alpha-glucosidase with acarviosyl-maltohexaose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3weoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3weoa2 c.1.8.13 (A:300-672) Maltase, catalytic domain {Beta vulgaris [TaxId: 161934]}
pemvldqytkligrpapmpywafgfhqcrwgyrdvneietvvdkyaeariplevmwtdid
ymdafkdftldpvhfpldkmqqfvtklhrngqryvpildpgintnksygtfirgmqsnvf
ikrdgnpylgsvwpgpvyypdfldpaarsfwvdeikrfrdilpidgiwidmneasnfits
aptpgstldnppykinnsggrvpinsktipatamhygnvteynahnlygflesqatreal
vrtsnerpfllsrstfagsgkytahwtgdnaarwddlqysiptmlnfglfgmpmigadic
gfaestteelcrrwiqlgafypfsrdhsardtthqelylwesvaasartvlglryqllpy
yytlmydanlrgi

SCOPe Domain Coordinates for d3weoa2:

Click to download the PDB-style file with coordinates for d3weoa2.
(The format of our PDB-style files is described here.)

Timeline for d3weoa2: