Lineage for d3wema1 (3wem A:40-299)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045105Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 protein domains)
    Pfam PF16863
  6. 2045109Protein Maltase, N-terminal domain [310749] (1 species)
  7. 2045110Species Beta vulgaris [TaxId:161934] [311004] (6 PDB entries)
  8. 2045114Domain d3wema1: 3wem A:40-299 [306737]
    Other proteins in same PDB: d3wema2, d3wema3, d3wema4
    automated match to d3w38a1
    complexed with nag, so4

Details for d3wema1

PDB Entry: 3wem (more details), 2.59 Å

PDB Description: Sugar beet alpha-glucosidase with acarviosyl-maltotetraose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3wema1:

Sequence, based on SEQRES records: (download)

>d3wema1 b.30.5.11 (A:40-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]}
aigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritda
nnrrweipnevlprpppppsppplsslqhlpkpipqnqptttvlshphsdlvftlfhttp
fgftiyrksthdvlfdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfq
lahnqiltlwnadiasfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgd
ritykviggiidlyifagrt

Sequence, based on observed residues (ATOM records): (download)

>d3wema1 b.30.5.11 (A:40-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]}
aigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritda
nnrrweipnevlprpppppspppqptttvlshphsdlvftlfhttpfgftiyrksthdvl
fdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadi
asfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidly
ifagrt

SCOPe Domain Coordinates for d3wema1:

Click to download the PDB-style file with coordinates for d3wema1.
(The format of our PDB-style files is described here.)

Timeline for d3wema1:

  • d3wema1 is new in SCOPe 2.06-stable