Lineage for d3wb8g_ (3wb8 G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008048Protein MyoVa globular tail domain (GTD) [310806] (2 species)
  7. 2008054Species Mouse (Mus musculus) [TaxId:10090] [311071] (2 PDB entries)
  8. 2008061Domain d3wb8g_: 3wb8 G: [306731]
    complexed with edo

Details for d3wb8g_

PDB Entry: 3wb8 (more details), 2.5 Å

PDB Description: Crystal Structure of MyoVa-GTD
PDB Compounds: (G:) Unconventional myosin-Va

SCOPe Domain Sequences for d3wb8g_:

Sequence, based on SEQRES records: (download)

>d3wb8g_ a.118.27.1 (G:) MyoVa globular tail domain (GTD) {Mouse (Mus musculus) [TaxId: 10090]}
dfqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrts
siadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyivgaitlnnlllrkdmc
swskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmc
nalttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpf
npsslaletiqipaslglgfiarv

Sequence, based on observed residues (ATOM records): (download)

>d3wb8g_ a.118.27.1 (G:) MyoVa globular tail domain (GTD) {Mouse (Mus musculus) [TaxId: 10090]}
dfqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrs
lltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehclt
nfdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetytldsilrqlnsfhsvm
cqhgmdpelikqvvkqmfyivgaitlnnlllrkdmcswskgmqirynvsqleewlrdknl
mnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvnefeer
vsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfiarv

SCOPe Domain Coordinates for d3wb8g_:

Click to download the PDB-style file with coordinates for d3wb8g_.
(The format of our PDB-style files is described here.)

Timeline for d3wb8g_:

  • d3wb8g_ is new in SCOPe 2.06-stable