SCOPe 2.06: Domain d3w38a3: 3w38 A:673-756

Lineage for d3w38a3 (3w38 A:673-756)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)

6. Protein Maltase, domain 3 [310753] (1 species)

7. Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries)

8. Domain d3w38a3: 3w38 A:673-756 [306723]
   Other proteins in same PDB: d3w38a1, d3w38a2, d3w38a4
   complexed with nag, so4

Details for d3w38a3

PDB Entry: 3w38, 2.79 Å

PDB Description: sugar beet alpha-glucosidase

PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3w38a3:

Sequence; same for both SEQRES and ATOM records:

>d3w38a3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]}
piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss
vsvsagtyvslsappdhinvhihe

Timeline for d3w38a3:

• d3w38a3 is new in SCOPe 2.06-stable
  
• d3w38a3 appears in SCOPe 2.07
  
• d3w38a3 appears in the current release, SCOPe 2.08