Lineage for d3w38a3 (3w38 A:673-756)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400882Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 protein domains)
  6. 2400883Protein Maltase, domain 3 [310753] (1 species)
  7. 2400884Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries)
  8. 2400890Domain d3w38a3: 3w38 A:673-756 [306723]
    Other proteins in same PDB: d3w38a1, d3w38a2, d3w38a4
    complexed with nag, so4

Details for d3w38a3

PDB Entry: 3w38 (more details), 2.79 Å

PDB Description: Sugar beet alpha-glucosidase
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3w38a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w38a3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]}
piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss
vsvsagtyvslsappdhinvhihe

SCOPe Domain Coordinates for d3w38a3:

Click to download the PDB-style file with coordinates for d3w38a3.
(The format of our PDB-style files is described here.)

Timeline for d3w38a3: