Lineage for d3w38a1 (3w38 A:39-299)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045105Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 protein domains)
    Pfam PF16863
  6. 2045109Protein Maltase, N-terminal domain [310749] (1 species)
  7. 2045110Species Beta vulgaris [TaxId:161934] [311004] (6 PDB entries)
  8. 2045116Domain d3w38a1: 3w38 A:39-299 [306721]
    Other proteins in same PDB: d3w38a2, d3w38a3, d3w38a4
    complexed with nag, so4

Details for d3w38a1

PDB Entry: 3w38 (more details), 2.79 Å

PDB Description: Sugar beet alpha-glucosidase
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3w38a1:

Sequence, based on SEQRES records: (download)

>d3w38a1 b.30.5.11 (A:39-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]}
eaigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritd
annrrweipnevlprpppppsppplsslqhlpkpipqnqptttvlshphsdlvftlfhtt
pfgftiyrksthdvlfdatpipsnpttfliykdqylqlssslpaqqahlyglgehtkptf
qlahnqiltlwnadiasfnrdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytg
dritykviggiidlyifagrt

Sequence, based on observed residues (ATOM records): (download)

>d3w38a1 b.30.5.11 (A:39-299) Maltase, N-terminal domain {Beta vulgaris [TaxId: 161934]}
eaigygyqvknakvdnstgksltallqlirnspvygpdiqflsftasfeeddtlriritd
annrrweipnevlprpppppptttvlshphsdlvftlfhttpfgftiyrksthdvlfdat
pipsnpttfliykdqylqlssslpaqqahlyglgehtkptfqlahnqiltlwnadiasfn
rdlnlygshpfymdvrsspmvgsthgvfllnsngmdveytgdritykviggiidlyifag
rt

SCOPe Domain Coordinates for d3w38a1:

Click to download the PDB-style file with coordinates for d3w38a1.
(The format of our PDB-style files is described here.)

Timeline for d3w38a1:

  • d3w38a1 is new in SCOPe 2.06-stable