Lineage for d3w37a3 (3w37 A:673-756)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810909Protein Maltase, domain 3 [310753] (2 species)
  7. 2810910Species Beta vulgaris [TaxId:161934] [311008] (6 PDB entries)
  8. 2810912Domain d3w37a3: 3w37 A:673-756 [306719]
    Other proteins in same PDB: d3w37a1, d3w37a2, d3w37a4
    automated match to d3w38a3
    complexed with acy, gol, nag, so4

Details for d3w37a3

PDB Entry: 3w37 (more details), 1.7 Å

PDB Description: sugar beet alpha-glucosidase with acarbose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d3w37a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w37a3 b.71.1.4 (A:673-756) Maltase, domain 3 {Beta vulgaris [TaxId: 161934]}
piarplfftfpddvatygissqfligrgimvspvlqpgavsvnayfprgnwfslfnytss
vsvsagtyvslsappdhinvhihe

SCOPe Domain Coordinates for d3w37a3:

Click to download the PDB-style file with coordinates for d3w37a3.
(The format of our PDB-style files is described here.)

Timeline for d3w37a3: