| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (17 species) not a true protein |
| Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries) |
| Domain d3vr6d3: 3vr6 D:352-454 [306708] Other proteins in same PDB: d3vr6d1, d3vr6d2, d3vr6e1, d3vr6e2, d3vr6f1, d3vr6f2, d3vr6g1, d3vr6g2 automated match to d3gqbb3 complexed with anp, mg |
PDB Entry: 3vr6 (more details), 2.68 Å
SCOPe Domain Sequences for d3vr6d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr6d3 a.69.1.0 (D:352-454) automated matches {Enterococcus hirae [TaxId: 1354]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkyl
Timeline for d3vr6d3: