Lineage for d3vr6d1 (3vr6 D:4-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798898Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries)
  8. 2798905Domain d3vr6d1: 3vr6 D:4-75 [306706]
    Other proteins in same PDB: d3vr6d2, d3vr6d3, d3vr6e2, d3vr6e3, d3vr6f2, d3vr6f3, d3vr6g1, d3vr6g2
    automated match to d3gqbb1
    complexed with anp, mg

Details for d3vr6d1

PDB Entry: 3vr6 (more details), 2.68 Å

PDB Description: crystal structure of amp-pnp bound enterococcus hirae v1-atpase [bv1]
PDB Compounds: (D:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr6d1 b.49.1.0 (D:4-75) automated matches {Enterococcus hirae [TaxId: 1354]}
eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi
nlknssvrflgh

SCOPe Domain Coordinates for d3vr6d1:

Click to download the PDB-style file with coordinates for d3vr6d1.
(The format of our PDB-style files is described here.)

Timeline for d3vr6d1: