Lineage for d3vr4f3 (3vr4 F:352-455)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002956Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2002957Protein automated matches [254528] (11 species)
    not a true protein
  7. 2003023Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries)
  8. 2003026Domain d3vr4f3: 3vr4 F:352-455 [306704]
    Other proteins in same PDB: d3vr4d1, d3vr4d2, d3vr4e1, d3vr4e2, d3vr4f1, d3vr4f2, d3vr4g_
    automated match to d3gqbb3
    complexed with b3p, cl, gol

Details for d3vr4f3

PDB Entry: 3vr4 (more details), 2.17 Å

PDB Description: Crystal structure of Enterococcus hirae V1-ATPase [eV1]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr4f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr4f3 a.69.1.0 (F:352-455) automated matches {Enterococcus hirae [TaxId: 1354]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

SCOPe Domain Coordinates for d3vr4f3:

Click to download the PDB-style file with coordinates for d3vr4f3.
(The format of our PDB-style files is described here.)

Timeline for d3vr4f3: