![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries) |
![]() | Domain d3vr4f3: 3vr4 F:352-455 [306704] Other proteins in same PDB: d3vr4d1, d3vr4d2, d3vr4e1, d3vr4e2, d3vr4f1, d3vr4f2, d3vr4g_ automated match to d3gqbb3 complexed with b3p, cl, gol |
PDB Entry: 3vr4 (more details), 2.17 Å
SCOPe Domain Sequences for d3vr4f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr4f3 a.69.1.0 (F:352-455) automated matches {Enterococcus hirae [TaxId: 1354]} kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp
Timeline for d3vr4f3: