Lineage for d3vr4f2 (3vr4 F:76-351)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871871Species Enterococcus hirae [TaxId:1354] [311346] (3 PDB entries)
  8. 2871874Domain d3vr4f2: 3vr4 F:76-351 [306703]
    Other proteins in same PDB: d3vr4d1, d3vr4d3, d3vr4e1, d3vr4e3, d3vr4f1, d3vr4f3, d3vr4g_
    automated match to d3gqbb2
    complexed with b3p, cl, gol

Details for d3vr4f2

PDB Entry: 3vr4 (more details), 2.17 Å

PDB Description: Crystal structure of Enterococcus hirae V1-ATPase [eV1]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr4f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr4f2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 1354]}
plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai
dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm
edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae
alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi
pdltgyitegqiiltrelyksgiqppidvlpslsrl

SCOPe Domain Coordinates for d3vr4f2:

Click to download the PDB-style file with coordinates for d3vr4f2.
(The format of our PDB-style files is described here.)

Timeline for d3vr4f2: