![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Enterococcus hirae [TaxId:1354] [311346] (3 PDB entries) |
![]() | Domain d3vr4f2: 3vr4 F:76-351 [306703] Other proteins in same PDB: d3vr4d1, d3vr4d3, d3vr4e1, d3vr4e3, d3vr4f1, d3vr4f3, d3vr4g_ automated match to d3gqbb2 complexed with b3p, cl, gol |
PDB Entry: 3vr4 (more details), 2.17 Å
SCOPe Domain Sequences for d3vr4f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr4f2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 1354]} plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi pdltgyitegqiiltrelyksgiqppidvlpslsrl
Timeline for d3vr4f2: