Lineage for d3vr4e3 (3vr4 E:352-455)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717605Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries)
  8. 2717607Domain d3vr4e3: 3vr4 E:352-455 [306701]
    Other proteins in same PDB: d3vr4d1, d3vr4d2, d3vr4e1, d3vr4e2, d3vr4f1, d3vr4f2, d3vr4g_
    automated match to d3gqbb3
    complexed with b3p, cl, gol

Details for d3vr4e3

PDB Entry: 3vr4 (more details), 2.17 Å

PDB Description: Crystal structure of Enterococcus hirae V1-ATPase [eV1]
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr4e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr4e3 a.69.1.0 (E:352-455) automated matches {Enterococcus hirae [TaxId: 1354]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

SCOPe Domain Coordinates for d3vr4e3:

Click to download the PDB-style file with coordinates for d3vr4e3.
(The format of our PDB-style files is described here.)

Timeline for d3vr4e3: