Lineage for d1dysb_ (1dys B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823184Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 823185Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) (S)
  5. 823186Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 proteins)
    Pfam PF01341
  6. 823187Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 823200Species Humicola insolens, Cel6b [TaxId:34413] [51996] (1 PDB entry)
  8. 823202Domain d1dysb_: 1dys B: [30670]

Details for d1dysb_

PDB Entry: 1dys (more details), 1.6 Å

PDB Description: endoglucanase cel6b from humicola insolens
PDB Compounds: (B:) endoglucanase

SCOP Domain Sequences for d1dysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dysb_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6b [TaxId: 34413]}
gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia

SCOP Domain Coordinates for d1dysb_:

Click to download the PDB-style file with coordinates for d1dysb_.
(The format of our PDB-style files is described here.)

Timeline for d1dysb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dysa_