Lineage for d3vr4e1 (3vr4 E:4-75)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2390559Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2390560Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2390779Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2390780Protein automated matches [254527] (11 species)
    not a true protein
  7. 2390846Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries)
  8. 2390848Domain d3vr4e1: 3vr4 E:4-75 [306699]
    Other proteins in same PDB: d3vr4d2, d3vr4d3, d3vr4e2, d3vr4e3, d3vr4f2, d3vr4f3, d3vr4g_
    automated match to d3gqbb1
    complexed with b3p, cl, gol

Details for d3vr4e1

PDB Entry: 3vr4 (more details), 2.17 Å

PDB Description: Crystal structure of Enterococcus hirae V1-ATPase [eV1]
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr4e1 b.49.1.0 (E:4-75) automated matches {Enterococcus hirae [TaxId: 1354]}
eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi
nlknssvrflgh

SCOPe Domain Coordinates for d3vr4e1:

Click to download the PDB-style file with coordinates for d3vr4e1.
(The format of our PDB-style files is described here.)

Timeline for d3vr4e1: