| Class b: All beta proteins [48724] (180 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
| Protein automated matches [254527] (17 species) not a true protein |
| Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries) |
| Domain d3vr4d1: 3vr4 D:4-75 [306696] Other proteins in same PDB: d3vr4d2, d3vr4d3, d3vr4e2, d3vr4e3, d3vr4f2, d3vr4f3, d3vr4g_ automated match to d3gqbb1 complexed with b3p, cl, gol |
PDB Entry: 3vr4 (more details), 2.17 Å
SCOPe Domain Sequences for d3vr4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr4d1 b.49.1.0 (D:4-75) automated matches {Enterococcus hirae [TaxId: 1354]}
eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi
nlknssvrflgh
Timeline for d3vr4d1: