| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (17 species) not a true protein |
| Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries) |
| Domain d3vr2f3: 3vr2 F:352-454 [306695] Other proteins in same PDB: d3vr2d1, d3vr2d2, d3vr2e1, d3vr2e2, d3vr2f1, d3vr2f2 automated match to d3gqbb3 |
PDB Entry: 3vr2 (more details), 2.8 Å
SCOPe Domain Sequences for d3vr2f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr2f3 a.69.1.0 (F:352-454) automated matches {Enterococcus hirae [TaxId: 1354]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkyl
Timeline for d3vr2f3: