Lineage for d3vr2f3 (3vr2 F:352-454)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717605Species Enterococcus hirae [TaxId:1354] [311347] (3 PDB entries)
  8. 2717611Domain d3vr2f3: 3vr2 F:352-454 [306695]
    Other proteins in same PDB: d3vr2d1, d3vr2d2, d3vr2e1, d3vr2e2, d3vr2f1, d3vr2f2
    automated match to d3gqbb3

Details for d3vr2f3

PDB Entry: 3vr2 (more details), 2.8 Å

PDB Description: Crystal structure of nucleotide-free A3B3 complex from Enterococcus hirae V-ATPase [eA3B3]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr2f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr2f3 a.69.1.0 (F:352-454) automated matches {Enterococcus hirae [TaxId: 1354]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkyl

SCOPe Domain Coordinates for d3vr2f3:

Click to download the PDB-style file with coordinates for d3vr2f3.
(The format of our PDB-style files is described here.)

Timeline for d3vr2f3: