Lineage for d3vr2f2 (3vr2 F:76-351)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871871Species Enterococcus hirae [TaxId:1354] [311346] (3 PDB entries)
  8. 2871877Domain d3vr2f2: 3vr2 F:76-351 [306694]
    Other proteins in same PDB: d3vr2d1, d3vr2d3, d3vr2e1, d3vr2e3, d3vr2f1, d3vr2f3
    automated match to d3gqbb2

Details for d3vr2f2

PDB Entry: 3vr2 (more details), 2.8 Å

PDB Description: Crystal structure of nucleotide-free A3B3 complex from Enterococcus hirae V-ATPase [eA3B3]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr2f2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 1354]}
plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai
dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm
edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae
alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi
pdltgyitegqiiltrelyksgiqppidvlpslsrl

SCOPe Domain Coordinates for d3vr2f2:

Click to download the PDB-style file with coordinates for d3vr2f2.
(The format of our PDB-style files is described here.)

Timeline for d3vr2f2: