![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
![]() | Protein automated matches [254527] (17 species) not a true protein |
![]() | Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries) |
![]() | Domain d3vr2f1: 3vr2 F:4-75 [306693] Other proteins in same PDB: d3vr2d2, d3vr2d3, d3vr2e2, d3vr2e3, d3vr2f2, d3vr2f3 automated match to d3gqbb1 |
PDB Entry: 3vr2 (more details), 2.8 Å
SCOPe Domain Sequences for d3vr2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr2f1 b.49.1.0 (F:4-75) automated matches {Enterococcus hirae [TaxId: 1354]} eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi nlknssvrflgh
Timeline for d3vr2f1: