Lineage for d3vr2f1 (3vr2 F:4-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798898Species Enterococcus hirae [TaxId:1354] [311345] (3 PDB entries)
  8. 2798904Domain d3vr2f1: 3vr2 F:4-75 [306693]
    Other proteins in same PDB: d3vr2d2, d3vr2d3, d3vr2e2, d3vr2e3, d3vr2f2, d3vr2f3
    automated match to d3gqbb1

Details for d3vr2f1

PDB Entry: 3vr2 (more details), 2.8 Å

PDB Description: Crystal structure of nucleotide-free A3B3 complex from Enterococcus hirae V-ATPase [eA3B3]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr2f1 b.49.1.0 (F:4-75) automated matches {Enterococcus hirae [TaxId: 1354]}
eyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegtsgi
nlknssvrflgh

SCOPe Domain Coordinates for d3vr2f1:

Click to download the PDB-style file with coordinates for d3vr2f1.
(The format of our PDB-style files is described here.)

Timeline for d3vr2f1: